LOCUS NM_025164 6212 bp mRNA linear PRI 20-DEC-2020 DEFINITION Homo sapiens SIK family kinase 3 (SIK3), transcript variant 1, mRNA. ACCESSION NM_025164 XM_370659 VERSION NM_025164.6 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 6212) AUTHORS Armouti M, Winston N, Hatano O, Hobeika E, Hirshfeld-Cytron J, Liebermann J, Takemori H and Stocco C. TITLE Salt-inducible Kinases Are Critical Determinants of Female Fertility JOURNAL Endocrinology 161 (7) (2020) PUBMED 32343771 REMARK GeneRIF: Salt-inducible Kinases Are Critical Determinants of Female Fertility. REFERENCE 2 (bases 1 to 6212) AUTHORS Hutchinson LD, Darling NJ, Nicolaou S, Gori I, Squair DR, Cohen P, Hill CS and Sapkota GP. TITLE Salt-inducible kinases (SIKs) regulate TGFbeta-mediated transcriptional and apoptotic responses JOURNAL Cell Death Dis 11 (1), 49 (2020) PUBMED 31969556 REMARK GeneRIF: Salt-inducible kinases (SIKs) regulate TGFbeta-mediated transcriptional and apoptotic responses. Publication Status: Online-Only REFERENCE 3 (bases 1 to 6212) AUTHORS Murray CW, Brady JJ, Tsai MK, Li C, Winters IP, Tang R, Andrejka L, Ma RK, Kunder CA, Chu P and Winslow MM. TITLE An LKB1-SIK Axis Suppresses Lung Tumor Growth and Controls Differentiation JOURNAL Cancer Discov 9 (11), 1590-1605 (2019) PUBMED 31350327 REMARK GeneRIF: An LKB1-SIK Axis Suppresses Lung Tumor Growth and Controls Differentiation. REFERENCE 4 (bases 1 to 6212) AUTHORS Csukasi F, Duran I, Barad M, Barta T, Gudernova I, Trantirek L, Martin JH, Kuo CY, Woods J, Lee H, Cohn DH, Krejci P and Krakow D. TITLE The PTH/PTHrP-SIK3 pathway affects skeletogenesis through altered mTOR signaling JOURNAL Sci Transl Med 10 (459) (2018) PUBMED 30232230 REFERENCE 5 (bases 1 to 6212) AUTHORS Tarumoto Y, Lu B, Somerville TDD, Huang YH, Milazzo JP, Wu XS, Klingbeil O, El Demerdash O, Shi J and Vakoc CR. TITLE LKB1, Salt-Inducible Kinases, and MEF2C Are Linked Dependencies in Acute Myeloid Leukemia JOURNAL Mol Cell 69 (6), 1017-1027 (2018) PUBMED 29526696 REMARK GeneRIF: Targeting of LKB1 or SIK3 diminishes histone acetylation at MEF2C-bound enhancers and deprives leukemia cells of the output of this essential TF. REFERENCE 6 (bases 1 to 6212) AUTHORS Kooner JS, Chambers JC, Aguilar-Salinas CA, Hinds DA, Hyde CL, Warnes GR, Gomez Perez FJ, Frazer KA, Elliott P, Scott J, Milos PM, Cox DR and Thompson JF. TITLE Genome-wide scan identifies variation in MLXIPL associated with plasma triglycerides JOURNAL Nat Genet 40 (2), 149-151 (2008) PUBMED 18193046 REFERENCE 7 (bases 1 to 6212) AUTHORS Al-Hakim AK, Goransson O, Deak M, Toth R, Campbell DG, Morrice NA, Prescott AR and Alessi DR. TITLE 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK JOURNAL J Cell Sci 118 (Pt 23), 5661-5673 (2005) PUBMED 16306228 REFERENCE 8 (bases 1 to 6212) AUTHORS Petroziello J, Yamane A, Westendorf L, Thompson M, McDonagh C, Cerveny C, Law CL, Wahl A and Carter P. TITLE Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer JOURNAL Oncogene 23 (46), 7734-7745 (2004) PUBMED 15334068 REFERENCE 9 (bases 1 to 6212) AUTHORS Katoh Y, Takemori H, Horike N, Doi J, Muraoka M, Min L and Okamoto M. TITLE Salt-inducible kinase (SIK) isoforms: their involvement in steroidogenesis and adipogenesis JOURNAL Mol Cell Endocrinol 217 (1-2), 109-112 (2004) PUBMED 15134808 REFERENCE 10 (bases 1 to 6212) AUTHORS Lizcano JM, Goransson O, Toth R, Deak M, Morrice NA, Boudeau J, Hawley SA, Udd L, Makela TP, Hardie DG and Alessi DR. TITLE LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1 JOURNAL EMBO J 23 (4), 833-843 (2004) PUBMED 14976552 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AP000936.7, AB023216.2, AP006216.1 and AI369377.1. On Jun 2, 2019 this sequence version replaced NM_025164.5. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: mixed/partial sample support SAMEA1965299, SAMEA1966682 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AP000936.7 177755-177794 c 41-4210 AB023216.2 291-4460 4211-6178 AP006216.1 132492-134459 c 6179-6212 AI369377.1 21-54 c FEATURES Location/Qualifiers source 1..6212 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="11" /map="11q23.3" gene 1..6212 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="SIK family kinase 3" /db_xref="GeneID:23387" /db_xref="HGNC:HGNC:29165" /db_xref="MIM:614776" exon 1..286 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" CDS 14..3979 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /EC_number="2.7.11.1" /note="isoform 1 is encoded by transcript variant 1; serine/threonine-protein kinase QSK; salt-inducible kinase 3; serine/threonine-protein kinase SIK3" /codon_start=1 /product="serine/threonine-protein kinase SIK3 isoform 1" /protein_id="NP_079440.3" /db_xref="CCDS:CCDS8379.2" /db_xref="GeneID:23387" /db_xref="HGNC:HGNC:29165" /db_xref="MIM:614776" /translation="MAAAAASGAGGAAGAGTGGAGPAGRLLPPPAPGSPAAPAAVSPA AGQPRPPAPASRGPMPARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKTQL DEENLKKIFREVQIMKMLCHPHIIRLYQVMETERMIYLVTEYASGGEIFDHLVAHGRM AEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKIADFGFSNLFTPGQL LKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVL SGKFRIPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGDADPNFDRLIAECQ QLKEERQVDPLNEDVLLAMEDMGLDKEQTLQSLRSDAYDHYSAIYSLLCDRHKRHKTL RLGALPSMPRALAFQAPVNIQAEQAGTAMNISVPQVQLINPENQIVEPDGTLNLDSDE GEEPSPEALVRYLSMRRHTVGVADPRTEVMEDLQKLLPGFPGVNPQAPFLQVAPNVNF MHNLLPMQNLQPTGQLEYKEQSLLQPPTLQLLNGMGPLGRRASDGGANIQLHAQQLLK RPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKDSNTLHLPTERFSPVRR FSDGAASIQAFKAHLEKMGNNSSIKQLQQECEQLQKMYGGQIDERTLEKTQQQHMLYQ QEQHHQILQQQIQDSICPPQPSPPLQAACENQPALLTHQLQRLRIQPSSPPPNHPNNH LFRQPSNSPPPMSSAMIQPHGAASSSQFQGLPSRSAIFQQQPENCSSPPNVALTCLGM QQPAQSQQVTIQVQEPVDMLSNMPGTAAGSSGRGISISPSAGQMQMQHRTNLMATLSY GHRPLSKQLSADSAEAHSLNVNRFSPANYDQAHLHPHLFSDQSRGSPSSYSPSTGVGF SPTQALKVPPLDQFPTFPPSAHQQPPHYTTSALQQALLSPTPPDYTRHQQVPHILQGL LSPRHSLTGHSDIRLPPTEFAQLIKRQQQQRQQQQQQQQQQEYQELFRHMNQGDAGSL APSLGGQSMTERQALSYQNADSYHHHTSPQHLLQIRAQECVSQASSPTPPHGYAHQPA LMHSESMEEDCSCEGAKDGFQDSKSSSTLTKGCHDSPLLLSTGGPGDPESLLGTVSHA QELGIHPYGHQPTAAFSKNKVPSREPVIGNCMDRSSPGQAVELPDHNGLGYPARPSVH EHHRPRALQRHHTIQNSDDAYVQLDNLPGMSLVAGKALSSARMSDAVLSQSSLMGSQQ FQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPSTCITDILLSYKHPEVSFSMEQAG V" misc_feature 224..226 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphothreonine. /evidence=ECO:0000244|PubMed:19369195; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 350..352 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphothreonine. /evidence=ECO:0000244|PubMed:19690332; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 674..676 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphothreonine, by LKB1. /evidence=ECO:0000244|PubMed:19369195, ECO:0000244|PubMed:23186163, ECO:0000269|PubMed:14976552, ECO:0000269|PubMed:30232230; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 1418..1420 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphothreonine. /evidence=ECO:0000244|PubMed:23186163, ECO:0000244|PubMed:24275569, ECO:0000269|PubMed:29211348; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 1664..1666 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphoserine. /evidence=ECO:0000244|PubMed:19369195, ECO:0000244|PubMed:23186163; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 1784..1786 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q6P4S6; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 1787..1789 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q6P4S6; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 1889..1891 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphoserine. /evidence=ECO:0000244|PubMed:18669648, ECO:0000244|PubMed:19369195, ECO:0000244|PubMed:23186163, ECO:0000244|PubMed:24275569; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 1952..1954 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q6P4S6; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 2609..2611 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphoserine. /evidence=ECO:0000244|PubMed:19369195, ECO:0000244|PubMed:23186163; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 2945..2947 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Phosphoserine. /evidence=ECO:0000244|PubMed:24275569; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); phosphorylation site" misc_feature 2969..2971 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="Omega-N-methylarginine. /evidence=ECO:0000250|UniProtKB:Q6P4S6; propagated from UniProtKB/Swiss-Prot (Q9Y2K2.4); methylation site" exon 287..403 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 404..467 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 468..629 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 630..754 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 755..878 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 879..997 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 998..1108 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 1109..1252 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 1253..1330 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 1331..1440 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 1441..1594 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 1595..1750 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 1751..1821 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 1822..1972 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 1973..2098 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 2099..2184 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 2185..2294 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 2295..2634 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 2635..3524 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 3525..3688 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 3689..3821 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 3822..3992 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" exon 3993..6212 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /inference="alignment:Splign:2.1.0" regulatory 4191..4196 /regulatory_class="polyA_signal_sequence" /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="hexamer: AATAAA" polyA_site 4211 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="major polyA site" regulatory 6187..6192 /regulatory_class="polyA_signal_sequence" /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" /note="hexamer: ATTAAA" polyA_site 6212 /gene="SIK3" /gene_synonym="L19; QSK; SEMDK; SIK-3" ORIGIN 1 actgcacaac aagatggcgg cggcggcggc gagcggagct ggcggggctg ccggggccgg 61 gactggggga gccgggcccg cgggccgcct gctgcctccg cccgcgccgg ggtccccagc 121 cgcccccgct gccgtgtccc ctgcggccgg ccagccgcgt cccccagccc cggcctcccg 181 cggacccatg cccgcccgta tcggctacta cgagatcgac cgcaccatcg gcaagggcaa 241 cttcgcggtg gtcaagcggg ccacgcacct cgtcaccaag gccaaggttg ctatcaagat 301 catagataag acccagctgg atgaagaaaa cttgaagaag attttccggg aagttcaaat 361 tatgaagatg ctttgccacc cccatatcat caggctctac caggttatgg agacagaacg 421 gatgatttat ctggtgacag aatatgctag tggaggggaa atatttgacc acctggtggc 481 ccatggtaga atggcagaaa aggaggcacg tcggaagttc aaacagatcg tcacagctgt 541 ctatttttgt cactgtcgga acattgttca tcgtgattta aaagctgaaa atttacttct 601 ggatgccaat ctgaatatca aaatagcaga ttttggtttc agtaacctct tcactcctgg 661 gcagctgctg aagacctggt gtggcagccc tccctatgct gcacctgaac tctttgaagg 721 aaaagaatat gatgggccca aagtggacat ctggagcctt ggagttgtcc tctacgtgct 781 tgtgtgcggt gccctgccat ttgatggaag cacactgcag aatctgcggg cccgcgtgct 841 gagtggaaag ttccgcatcc cattttttat gtccacagaa tgtgagcatt tgatccgcca 901 tatgttggtg ttagatccca ataagcgcct ctccatggag cagatctgca agcacaagtg 961 gatgaagcta ggggacgccg atcccaactt tgacaggtta atagctgaat gccaacaact 1021 aaaggaagaa agacaggtgg accccctgaa tgaggatgtc ctcttggcca tggaggacat 1081 gggactggac aaagaacaga cactgcagtc attaagatca gatgcctatg atcactatag 1141 tgcaatctac agcctgctgt gtgatcgaca taagagacat aaaaccctgc gtctcggagc 1201 acttcctagc atgccccgag ccctggcctt tcaagcacca gtcaatatcc aggcggagca 1261 ggcaggtact gctatgaaca tcagcgttcc ccaggtgcag ctgatcaacc cagagaacca 1321 aattgtggag ccggatggga cactgaattt ggacagtgat gagggtgaag agccttcccc 1381 tgaagcattg gtgcgctatt tgtcaatgag gaggcacaca gtgggtgtgg ctgacccacg 1441 cacggaagtt atggaagatc tgcagaagct cctacctggc tttcctggag tcaaccccca 1501 ggctccattc ctgcaggtgg cccctaatgt gaacttcatg cacaacctgt tgcctatgca 1561 aaacttgcaa ccaaccgggc aacttgagta caaggagcag tctctcctac agccgcccac 1621 gctacagctg ttgaatggaa tgggccccct tggccggagg gcatcagatg gaggagccaa 1681 catccaactg catgcccagc agctgctgaa gcgcccacgg ggaccctctc cgcttgtcac 1741 catgacacca gcagtgccag cagttacccc tgtggacgag gagagctcag acggggagcc 1801 agaccaggaa gctgtgcaga gctctaccta caaggactcc aacactctgc acctccctac 1861 ggagcgtttc tcccctgtgc gccggttctc agatggggct gcgagcatcc aggccttcaa 1921 agctcacctg gaaaaaatgg gcaacaacag cagcatcaaa cagctgcagc aggagtgtga 1981 gcagctgcag aagatgtacg gggggcagat tgatgaaaga accctggaga agacccagca 2041 gcagcatatg ttataccagc aggagcagca ccatcaaatt ctccagcaac aaattcaaga 2101 ctctatctgt cctcctcagc catctccacc tcttcaggct gcatgtgaaa atcagccagc 2161 cctccttacc catcagctcc agaggttaag gattcagcct tcaagcccac cccccaacca 2221 ccccaacaac catctcttca ggcagcccag taatagtcct ccccccatga gcagtgccat 2281 gatccagcct cacggggctg catcttcttc ccagtttcaa ggcttacctt cccgcagtgc 2341 aatctttcag cagcaacctg agaactgttc ctctcctccc aacgtggcac taacctgctt 2401 gggtatgcag cagcctgctc agtcacagca ggtcaccatc caagtccaag agcctgttga 2461 catgctcagc aacatgccag gcacagctgc aggctccagt gggcgcggca tctccatcag 2521 ccccagtgct ggtcagatgc agatgcagca ccgtaccaac ctgatggcca ccctcagcta 2581 tgggcaccgt cccttgtcca agcagctgag tgctgacagt gcagaggctc acagcttgaa 2641 cgtgaatcgg ttctcccctg ctaactacga ccaggcgcat ttacaccccc atctgttttc 2701 ggaccagtcc cggggttccc ccagcagcta cagcccttca acaggagtgg ggttctctcc 2761 aacccaagcc ctgaaagtcc ctccacttga ccaattcccc accttccctc ccagtgcaca 2821 tcagcagccg ccacactata ccacgtcggc actacagcag gccctgctgt ctcccacgcc 2881 gccagactat acaagacacc agcaggtacc ccacatcctt caaggactgc tttctccccg 2941 gcattcgctc accggccact cggacatccg gctgccccca acagagtttg cacagctcat 3001 taaaaggcag cagcaacaac ggcagcagca gcagcaacag cagcaacagc aagaatacca 3061 ggaactgttc aggcacatga accaagggga tgcggggagt ctggctccca gccttggggg 3121 acagagcatg acagagcgcc aggctttatc ttatcaaaat gctgactctt atcaccatca 3181 caccagcccc cagcatctgc tacaaatcag ggcacaagaa tgtgtctcac aggcttcctc 3241 acccaccccg ccccacgggt atgctcacca gccggcactg atgcattcag agagcatgga 3301 ggaggactgc tcgtgtgagg gggccaagga tggcttccaa gacagtaaga gttcaagtac 3361 attgaccaaa ggttgccatg acagccctct gctcttgagt accggtggac ctggggaccc 3421 tgaatctttg ctaggaactg tgagtcatgc ccaagaattg gggatacatc cctatggtca 3481 tcagccaact gctgcattca gtaaaaataa ggtgcccagc agagagcctg tcatagggaa 3541 ctgcatggat agaagttctc caggacaagc agtggagctg ccggatcaca atgggctcgg 3601 gtacccagca cgcccctccg tccatgagca ccacaggccc cgggccctcc agagacacca 3661 cacgatccag aacagcgacg atgcttatgt acagctggat aacttgccag gaatgagtct 3721 cgtggctggg aaagcactta gctctgcccg gatgtcggat gcagttctca gtcagtcttc 3781 gctcatgggc agccagcagt ttcaggatgg ggaaaatgag gaatgtgggg caagcctggg 3841 aggtcatgag cacccagacc tgagtgatgg cagccagcat ttaaactcct cttgctatcc 3901 atctacgtgt attacagaca ttctgctcag ctacaagcac cccgaagtct ccttcagcat 3961 ggagcaggca ggcgtgtaac aagaaacaga gagttttgtg tacagcttgg gaatgaaaag 4021 gttgattgta aacccacagt atctagcagc gttgtgccaa attgcccttg tgtttctctc 4081 cacccaaaat atcacagctg ctttcctcac atttggttca tccgtgtgct gttcttttgg 4141 gttctgagag ggttttgcca tgtttgcttg tatgaccaag tcaccaagga aataaacagg 4201 aaggaaatcc atgttctcca tcttttgtga aagtatattt gagttggtgg ttttttgttt 4261 tgtttggggg tttgtgtttt gttttgtttt tggtatgttt tcttccagag gtgatatact 4321 ttcttttttt tcttcctttc ttttttttct ttcgttcctt ttttgaaaca ggagagcaaa 4381 gcagttagag ttcagaggcc agcggcctca gggccactcc ctccctagcc ttcatcagca 4441 gagcaccctc catccccctg cattgctctt ctgtgaaagc aaatactaaa ggatgccatc 4501 ctctggaatc ctaatggcag gcaaagggag agaggaaggg tgacggcttc tggcacttag 4561 aaaacaaaaa gaacaaaaaa agagaaaccc ccaagcctgg aacgcagaga ggtctttact 4621 gctgggatcc acggaaaaca tgtctgtcct agccaagatc atatgaagag tttggcacgg 4681 aggctgagaa tgacctggca tagatggttt gccagttagg atgtctcaat ttgagccttt 4741 gcttttggtg gataactcag ctcccctctt gtaacctgga aagttggttg cctttatcat 4801 cctgctggtt ttatccatgg actgaacacc caacagcagt gcactatgct ttctatggca 4861 tctttcattc tcattttata ttgtgctata aaaaggattg tttctccata tatatattat 4921 atatgtgtgt atatatataa tataatatat gtgtatatat atattatata tataatatat 4981 aatataatat attatatata tattatatat ataatatata tataaaatat atatatatat 5041 gctctcctct ttcagcctct ttgtcacagg gaagaagtgt aggaggttgc cttgggccct 5101 gcctctctcc taacctcctc ttccccactg ggtaccctca gcccctatat tttaattctt 5161 gatcatgtag aaattgtttt tggtaaatgt tgatattatt gttattatca ttattaataa 5221 ataaagagaa aaggaatttt tgtttaaatg agaaatgttt aaccagattc tgttctattt 5281 gaattgtgac ttgcaccttt tgttcaaagt atttccttta ggcattgtaa ttgtgaacag 5341 ctcttacttg tgccagtgac agatgcagtg gtctcctttc cccagttgaa gcagtgcata 5401 cgcagtagct attatttgtg ttatctttat ttctcttcat tgttagaaac caaagtcttc 5461 tctgctggct ggggctgaga gagggtctgg gttatctcct tctgatcttc aaaacaagag 5521 agagaccttg aatacactga ctcttccacc cttttttttt ctgggaaagg agagcaagag 5581 gtcccgagtc ccctcctagt ctttcatcct gaatttgcac agaggaaagc gggtgcccgg 5641 catggccatc ctgatgttgc tggcgggatc cccatgcacc ttgtccttct ccactgatac 5701 tggcagctcg gctcctggac ccaagatccc ttgagtggaa ttctgcagtg caagagccct 5761 tcgtgggagc tgtcccatgt ttccatggtc cccagtctcc cctccacttg gtggggtcac 5821 caactactca ccagaagggg gcttaccaag aaagccctaa aaagctgttg acttatctgc 5881 gcttgttcca actcttatgc ccccaacctg ccctaccacc accacgcgct cagcctgatg 5941 tgtttacatg gtactgtatg tatgggagag cagactgcac cctccagcaa caacagatga 6001 aagccagtga gcctactaac cgtgccatct tgcaaactac actttaaaaa aaactcattg 6061 ctttgtattg tagtaaccaa tatgtgcagt atacgttgaa tgtatatgaa catactttcc 6121 tatttctgtt ctttgaaaat gtcagaaata tttttttctt tctcatttta tgttgaacta 6181 aaaaggatta aaaaaaaaat ctccagactc aa //